The structure for the small protein Betacellulin that is shown was determined by two-dimensional nuclear magnetic resonance spectroscopy. The species that BTC was taken from was Homo sapiens.This particular molecule of BTC has a formula weight of 5916.9 and its sequence was determined to be RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.