02 décembre 2012

Function of Annexin A1

Annexin A1 belongs to the annexin family of Ca2+-dependent phospholipid-binding proteins that have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity.
Posté par tnfalpha à 13:31 - Commentaires [0] - Permalien [#]

02 décembre 2012

Annexin A1

Annexin A1 also known as lipocortin I is a protein that in humans is encoded by the ANXA1 gene. Annexin-A1 has also been shown to be protective against DNA damage induced by heat in breast cancer cells, adding to the evidence that it has tumor suppressive and protective activities. When ANXA1 is silenced or lost in cancer, cells are more prone to DNA damage, indicating its unidentified diverse role in genome maintenance or integrity.
Posté par tnfalpha à 13:30 - Commentaires [0] - Permalien [#]
01 décembre 2012

About the Image for Betacellulin

The structure for the small protein Betacellulin that is shown was determined by two-dimensional nuclear magnetic resonance spectroscopy. The species that BTC was taken from was Homo sapiens.This particular molecule of BTC has a formula weight of 5916.9 and its sequence was determined to be RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Posté par tnfalpha à 15:26 - Commentaires [0] - Permalien [#]
01 décembre 2012

Structure of Betacellulin

Betacellulin was originally identified as a growth-promoting factor in mouse pancreatic β-cell carcinoma cell line and has since been identified in humans. Mouse BTC (mBTC) is expressed as a 178-amino acid precursor. The membrane-bound precursor is cleaved to yield mature secreted mBTC. BTC is synthesized in a wide range of adult tissues and in many cultured cells, including smooth muscle cells and epithelial cells. The amino acid sequence of mature mBTC is 82.5%, identical with that of human BTC (hBTC), and both exhibit significant... [Lire la suite]
Posté par tnfalpha à 15:26 - Commentaires [0] - Permalien [#]
01 décembre 2012

Betacellulin

Betacellulin is a protein that in humans is encoded by the BTC gene located on chromosome 4 at locus 4q13-q21. Betacellulin is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor.
Posté par tnfalpha à 15:26 - Commentaires [0] - Permalien [#]