20 décembre 2012

High impact information on Batroxobin

In conclusion, intraoperative angioscopy provides visual assessment of luminal patency and anastomotic anatomy . Changes in coronary plaque color and morphology by lipid-lowering therapy with atorvastatin: serial evaluation by coronary Batroxobin.
Posté par tnfalpha à 02:48 - Commentaires [0] - Permalien [#]

20 décembre 2012

Batroxobin

Batroxobin is a serine protease derived from the venom of Bothrops atrox. Its molecular weight is approximately 43,000 g/mol−1. This thrombin-like proteolytic enzyme splits the 16 Arg-17 Gly bond in the A(alpha)-chain of fibrinogen, releasing fibrinopeptide A and leading to the clot formation through aggregation of formed of fibrin I monomer or Des-AA-monomer. In contrast to other anti-coagulants, it does not affect the functions of platelets. Hence, Batroxobin is used to determine fibrinogen in plasma, to measure a 'batroxobin... [Lire la suite]
Posté par tnfalpha à 02:47 - Commentaires [0] - Permalien [#]
18 décembre 2012

High impact information on Anxa1

Blocked negative selection of developing T cells in mice expressing the baculovirus p35 caspase inhibitor. We have purified two phospholipase A2 inhibitory proteins (Annexin A1) from peritoneal fluid of dexamethasone-treated rats. Dexamethasone induces the synthesis of a phospholipase A2-inhibitory protein (PLIP) of molecular weight approximately equal to 55,000 from calf thymus and PLIPs of molecular weights 55,000, 40,000, 28,000, and 15,000 from A/J mouse thymus and from 12-day embryonic B10.
Posté par tnfalpha à 14:44 - Commentaires [0] - Permalien [#]
18 décembre 2012

Disease relevance of Anxa1

In the zymosan peritonitis model, AnxA1 null mice displayed a higher degree (50-70%) of PMN recruitment compared with wild-type littermate mice, and this was associated with reduced numbers of F4/80+ cells . Down-regulation of the anti-inflammatory protein Annexin A1 in cystic fibrosis knock-out mice and patients.
Posté par tnfalpha à 14:44 - Commentaires [0] - Permalien [#]
18 décembre 2012

annexin A1 Mus musculus

tnfalpha.canalblog.com
Posté par tnfalpha à 14:44 - Commentaires [0] - Permalien [#]
02 décembre 2012

Inflammation with Annexin A1

Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins, and leukotrienes, Annexin A1 may have potential anti-inflammatory activity. Glucocorticoids stimulate production of lipocortin. In this way, synthesis of eicosanoids are inhibited.
Posté par tnfalpha à 13:31 - Commentaires [0] - Permalien [#]

02 décembre 2012

Function of Annexin A1

Annexin A1 belongs to the annexin family of Ca2+-dependent phospholipid-binding proteins that have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity.
Posté par tnfalpha à 13:31 - Commentaires [0] - Permalien [#]
02 décembre 2012

Annexin A1

Annexin A1 also known as lipocortin I is a protein that in humans is encoded by the ANXA1 gene. Annexin-A1 has also been shown to be protective against DNA damage induced by heat in breast cancer cells, adding to the evidence that it has tumor suppressive and protective activities. When ANXA1 is silenced or lost in cancer, cells are more prone to DNA damage, indicating its unidentified diverse role in genome maintenance or integrity.
Posté par tnfalpha à 13:30 - Commentaires [0] - Permalien [#]
01 décembre 2012

About the Image for Betacellulin

The structure for the small protein Betacellulin that is shown was determined by two-dimensional nuclear magnetic resonance spectroscopy. The species that BTC was taken from was Homo sapiens.This particular molecule of BTC has a formula weight of 5916.9 and its sequence was determined to be RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Posté par tnfalpha à 15:26 - Commentaires [0] - Permalien [#]
01 décembre 2012

Structure of Betacellulin

Betacellulin was originally identified as a growth-promoting factor in mouse pancreatic β-cell carcinoma cell line and has since been identified in humans. Mouse BTC (mBTC) is expressed as a 178-amino acid precursor. The membrane-bound precursor is cleaved to yield mature secreted mBTC. BTC is synthesized in a wide range of adult tissues and in many cultured cells, including smooth muscle cells and epithelial cells. The amino acid sequence of mature mBTC is 82.5%, identical with that of human BTC (hBTC), and both exhibit significant... [Lire la suite]
Posté par tnfalpha à 15:26 - Commentaires [0] - Permalien [#]